PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010090688.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NAC
Protein Properties Length: 277aa    MW: 31564.2 Da    PI: 8.844
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010090688.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.25.7e-52141381128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelvv+yLk+k+ +++l++ ++i+evd++k++PwdLp      e+e yfFs+++ ky++g+r+nrat +gyWkatg dk+++s+
  XP_010090688.1  14 LPPGFRFHPTDEELVVQYLKRKAFSHPLPA-SIIPEVDVCKSDPWDLPGD---LEQERYFFSTKEAKYPNGNRSNRATGTGYWKATGIDKQIVSS 104
                     79****************************.89***************54...46799**********************************998 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++vg+kktLvfy+g+ p+g++tdW+mheyrl
  XP_010090688.1 105 kGNQVVGMKKTLVFYRGKPPHGSRTDWIMHEYRL 138
                     57778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-6110162IPR003441NAC domain
PROSITE profilePS5100558.75614162IPR003441NAC domain
PfamPF023659.1E-2715138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010089Biological Processxylem development
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MEKLNFVKNG VLRLPPGFRF HPTDEELVVQ YLKRKAFSHP LPASIIPEVD VCKSDPWDLP  60
GDLEQERYFF STKEAKYPNG NRSNRATGTG YWKATGIDKQ IVSSKGNQVV GMKKTLVFYR  120
GKPPHGSRTD WIMHEYRLVN TSSQSPVEIP MENWVLCRIF LKKRASKNEE ENCGGELVAR  180
KATRVMRSNN ATTSTTSNRP VFYDFMRKEN TERERERADL NLALSSSSSG SSGITEVSSN  240
NNQEEESSDD HQEEDSSSCN TISTTTFPYF RRKQNSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-551216715170NO APICAL MERISTEM PROTEIN
1ut4_B9e-551216715170NO APICAL MERISTEM PROTEIN
1ut7_A9e-551216715170NO APICAL MERISTEM PROTEIN
1ut7_B9e-551216715170NO APICAL MERISTEM PROTEIN
3swm_A1e-541216718173NAC domain-containing protein 19
3swm_B1e-541216718173NAC domain-containing protein 19
3swm_C1e-541216718173NAC domain-containing protein 19
3swm_D1e-541216718173NAC domain-containing protein 19
3swp_A1e-541216718173NAC domain-containing protein 19
3swp_B1e-541216718173NAC domain-containing protein 19
3swp_C1e-541216718173NAC domain-containing protein 19
3swp_D1e-541216718173NAC domain-containing protein 19
4dul_A9e-551216715170NAC domain-containing protein 19
4dul_B9e-551216715170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00507DAPTransfer from AT5G13180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010090688.10.0NAC domain-containing protein 29
SwissprotQ9FY931e-104NAC83_ARATH; NAC domain-containing protein 83
TrEMBLW9QTV80.0W9QTV8_9R
STRINGPOPTR_0001s13380.11e-128(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.11e-101NAC domain containing protein 83